i) Write down the equation derived from your Excel generated standard curve , figure legend and describe its components; ii) provide the values of the absorbance data of the unknown sample (do NOT show the absorbance data of the glycine standards). Show all details of the working out of your calculation. Indicate all units! Provide the answer with two decimals precision
Q: Question 5 of 10 Among the given statements, which one(s) is/are correct about alpha keratin? 1. It…
A: Alpha-keratin is a protein found in vertebrates. It is found in nails, hairs, claws and epidermis of…
Q: compute the yield of ATP when one molecule of hexanoic acid (6:0 fatty acid) is completely oxidized…
A: Aerobic respiration is a metabolic pathway that breaks down organic molecules, such as glucose and…
Q: Anti Lice Oil from Guyabano (Annona Muricata L.) Seed Extract
A: Infestations of lice are a widespread issue, and interest in all-natural cures is rising. The…
Q: What is the denaturant in Anfinsen’s classic experiment to demonstrate that reduced and denatured…
A: Protein folding is a ordered set of pathways which leads to the formation of native conformation of…
Q: Give typed full explanation If hypertension is left untreated, the risk of dying from cardiac…
A: It is a condition of increased blood pressure. In general, blood pressure reading of 130/80 mm Hg…
Q: Based on the image below, select the correct statement. (b) Glyceraldehyde 3-phosphate (2) 2P₁…
A: Glycolysis is a metabolic pathway that oxidises 1 molecule of glucose into 2 molecules of pyruvate…
Q: Which of the following is not involved in the post-transcriptional processing of t-RNA? a)…
A: a) Attachment of poly-A tail: Poly-A tails are typically added to the 3' end of eukaryotic mRNA…
Q: Passive transport across the membrane mediated by a carrier— would not be saturated by…
A: Membrane transport refers to the movement of ions, molecules, and other substances across the cell…
Q: The buffer systems of blood, their role in maintenance of acid-base homeostasis
A: A buffer is a solution that can resist changes in pH when small quantities of acid or base are added…
Q: Are the Embden-Meyerhoff-Parnas pathway, transition reaction and the Krebs cycle connected?? If so,…
A: Cellular respiration is the process how biochemical energy is generated from food. It involves the…
Q: H₂N. OH + H₂N. OH enzyme
A: Here we are looking at an enzyme catalyzed reversible reaction between 2 amino acids, alanine and…
Q: 10. Short note on transport and storage of ammonia.
A: Ammonia (NH3) is a commonly used gas in various industrial applications, such as fertilizers,…
Q: Draw Glycolysis. Please make sure to state all the enzymes and co-factors for each step of the…
A: Glycolysis is the metabolic pathway that converts 1 molecule of glucose to 2 molecules of pyruvate.…
Q: Which of the following gives rise to y-amino butyrate? a) Pyruvate decarboxylation b) Glutamine…
A: γ-Amino butyrate (GABA) is an amino acid derivative that is synthesized from glutamate through a…
Q: Please explain the significance of this diagram with respect to cancer/tumor development. Tumor…
A: Let us first understand the metabolism for energy production in cell. In any cell, glucose is the…
Q: Looking at the structure of alpha linolenic acid, how many rounds of beta oxidation will occur to…
A: Introduction: In biochemistry and metabolism, beta-oxidation is the catabolic process by which fatty…
Q: N-acetylphenylalaninamide 2. (a) is a substrate of a-chymotrypsin. Draw the structural formula of…
A: Chymotrypsin is a Serine protease that hydrolyses peptides bonds at the Carboxy terminus of Aromatic…
Q: 1. Provide the best coenzyme(s) for each step shown below. Give a 1–2 sentence rationale for your…
A: Enzymes are biological catalysts that catalyse biochemical reactions. Most enzymes are made up of…
Q: Describe a peptide bond formation and it’s physical properties.
A: A peptide bond is the bond formed between amino acids in a polypeptide chain. A peptide bond is…
Q: The limit for G-200 beads is 5000-600,000. When you pass two proteins- Protein A (75, 000), Protein…
A: The concept here relates to the use of gel filtration chromatography, which is a type of size…
Q: Canavanine is an example of __________ and cocaine is an example of _______. a. an alkaloid,…
A: Metabolism or metabolic process is the series of chemical processes occurring in a living cell.…
Q: Draw the structures of the products formed by hydrolysis of the following tripeptide at…
A: Hydrolysis of the tripeptide Val-Gly-Ile will be the three respective amino acid residues of the…
Q: Which of the following best describes the peptide backbone in a β-sheet? Group of answer choices…
A: A β-sheet is a common secondary structure motif found in proteins, consisting of multiple…
Q: Glycogen storage disease type VII or Tarui disease is a rare, autosomal recessive muscular…
A: As described in the text, Tarui disease or glycogen storage disease type VII is a disease that…
Q: What compound(s) were the most effective inhibitors and what compound(s) were the most effective…
A: ATCase is more commonly known as Aspartate carbamoyltransferase or aspartate transcarbamoylase.…
Q: D, Since the pK values for aspartic acid are 2.0, 3.9 and 10.0, it follows that the isoelectric (pH)…
A: The isoelectric point of an amino acid is the pH at which it has no net charge. To determine the…
Q: 9. Sulphur containing amino acid is (A) Methionine (B) Leucine (C) Valine (D) Asparagine
A: The above answer explains why Methionine is the correct answer to the question "Sulphur containing…
Q: 3. pH (isoelectric pH) of alanine is (A) 6.02 (B) 6.6 (C) 6.8 (D) 7.2
A: The question asked about the isoelectric pH (pI) of alanine, which is the pH at which the molecule…
Q: Block diagrams representing the general structures of two types of lipids are drawn. Which terms…
A: The most commom lipids in the body are the triacylglycerols. They contain a glycerol backbone and 3…
Q: 11. How many amino acid residues are there in ubiquitin? a) 70 b) 72 c) 74 d) 76
A: Ubiquitin is a small but highly versatile protein found in all eukaryotic cells. Its primary role is…
Q: 2. A polysacchharide which is often called animal starch is (A) Glycogen (B) Starch (C) Inulin (D)…
A: The question asked about the polysaccharide that is commonly referred to as "animal starch," and the…
Q: 3. The structure of phenylalanine is shown to the right. (a) Will phenylalanine test positive or…
A: Phenylalanine is an aromatic amino acid. It has a phenyl group for side chain. Different…
Q: Why is there a difference between the stock solution concentration of chymotrypsin calculated from…
A: Chymotrypsin is a digestive enzyme that breaks down proteins in the small intestine. It is commonly…
Q: Which of the following has the lowest level of chromosome organization? a) 30mm fiber >) Nuclecsome…
A: Chromosome organization refers to the structure and arrangement of chromosomes within the nucleus of…
Q: Assume that mitochondria contain 0.35 Molar KCL and 0.012 Molar NaCl. Calculate the grams per liter,…
A: Mitochondria has: Molarity of KCl = 0.35 M Molarity of NaCl = 0.012 M It is required to calculate…
Q: What is the Keq of Reaction #3? Show your work & clearly label your answer. Is Reaction #3…
A: In a general reaction such as: aA + bB ⇌ cC + dD At equilibrium (steady state), the concentration of…
Q: Which of the following enzymes is unique to the liver? Beta-hydroxybutyrate dehydrogenase HMG-CoA…
A: Proteins that catalyse chemical reactions in living organisms are known as enzymes. They function as…
Q: D. The correct sequence of cytochrome carriers in respiratory chain is (A) Cyt b-cyt c-cyt c1-cyt…
A: The respiratory chain is a series of protein complexes and electron carriers that facilitate the…
Q: In humans, a dietary essential fatty acid is (A) Palmitic acid (B) Stearic acid (C) Oleic acid (D)…
A: The answer to the question "In humans, a dietary essential fatty acid is" is (D) Linoleic acid.…
Q: Glucose 6-phosphate can be used for other purposes apart from energy production_ Which of the…
A: Once inside the cell, glucose is phosphorylated by hexokinase to prevent it from leaving the cell.…
Q: Explain about Deamination and transdeamination.
A: Amino acids are fundamental building blocks of proteins and play crucial roles in numerous…
Q: Complex 4 is also known as a) Cytochrome oxidase b) NADH dehydrogenase c) Succinate dehydrogenase d)…
A: Cytochrome oxidase, also known as Complex 4, is an enzyme complex found in the electron transport…
Q: In this diagram of an affinity label/suicide inhibitor at play, what is the difference between the…
A: TPCK is an abbreviation for "N-tosyl-L-phenylalanine chloromethyl ketone." It is a chemical molecule…
Q: Which of the following statement is not true? In a secondary structure the consecutive…
A: The secondary structure of a protein refers to the spatial arrangement of the main chain atoms of…
Q: I can select only one false option you are mentioning 2 false questions please pick one
A: The free energy released from oxidation of glucose to carbon-dioxide is stored in the form of…
Q: Which of the following is not involved in the post-transcriptional processing of t-RNA? a)…
A: a) Attachment of poly-A tail: Poly-A tails are typically added to the 3' end of eukaryotic mRNA…
Q: Passive transport Facilitated diffusion Both Neither
A: Introduction :- The question is about the cell transport were cell transport it's material like…
Q: Which of the following is a heteropolysaccharide?
A: Polysaccharides are complex carbohydrates made up of long chains of monosaccharides. They can be…
Q: A laboratory technician has been tasked to generate a solution for an enzymatic reaction. The…
A: Stock solution is the given solution present in lab. From the stock solution, we make the working…
Q: Consider a liver cell carrying out the oxidation of glucose and fatty acids under aerobic…
A: ATP is the energy currency of the cell and is primarily produced by ATP synthase present in the…
- i) Write down the equation derived from your Excel generated standard curve , figure legend and describe its components;
- ii) provide the values of the absorbance data of the unknown sample (do NOT show the absorbance data of the glycine standards). Show all details of the working out of your calculation. Indicate all units! Provide the answer with two decimals precision
Step by step
Solved in 3 steps with 1 images
- 8 period light reaction - Google 1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit LEY RA STANLEY-protein-synthesis-worksheet_practice-converted D O dit View Insert Format Tools Add-ons Help Last edit was 9 minutes ago 100% - Normal text Noto Sans . 12 BIUA 叫, 三三▼ = I 1 1 2 3. 5 . . 6 7 6. DNA → TAC CTT AGT TAT CCA TTG ACT CGA ATT GTG CGC TTG CTG ATC MRNA → protein > 7. DNA → ACC CGA TAC CTC TCT TAT AGC ATT ACA AAC CTC CGA GCG MRNA → protein → Sign out 7 8. 3 4. e6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…0.9% salt (NaCl) concentration is isotonic to red blood cells. What would happen to a patient's red blood cells if she accidently received an intravenous fluid in the hospital that was made with 0.09% salt solution Edit View Insert Format Tools Table 12pt v Paragraph v B I U AV e T?v
- sicruz@student.f x olfu.instructure.com/courses/137195/quizzes/2350874/take 2022 2023 ents ons ements tions utton HPCT 311 LAB MEDTECH 3-YA-1 X rive Question 14 10% aqueous nitric acid Nitric acid based decalcifying agent best used for staining nuclear and cytoplasmic structures at the same time. O Formol-nitric acid O Phloroglucin-nitric acid O None of the choices. Question 15 Which of the following is a chromic acid based decalcifying agent? Flemming's fluid O Zenker's fluid Von Ebner's fluid O Perenyi's fluid HPCT 311 Midterm Topics - YouT X Question 16 Acts as both fixative and decalcifying agent. POCO X4 PRO 5G Flemming's fluid Quiz: Midterm Practical Quiz L X (1) Facebook X 1 pts 1 pts 11/10/2022 15:40 1 ptsI need help with determining size fragmentוןווד ← Q Lab Report 6 worksheets 314 F22 .DOCX File Edit View Insert Format Tools Help A 100% ¿ Summary Grades for Arysta Visser: 23 x M Uh-oh! There's a problem w X b The restriction EcoRI cleaves X + Untitled spreadsheet - Goog X https://docs.google.com/document/d/1mKY1HIgMPRh1kRDCmX7msBF2yf07-ogT/edit Outline Headings you add to the document will appear here. Normal text Times ... 12 + B I U 2 18. The restriction EcoRI cleaves double-stranded DNA at the sequence 5'-GAATTC-3', the restriction enzyme HindIII cleaves at the sequence 5'-AAGCTT-3', and the restriction enzyme BamHI cleaves at 5'GGATCC-3. An 805 bp circular plasmid is digested with each enzyme individually and then in combination, and the resulting fragment sizes are determined by means of electrophoresis. The results are as follows: 1 Restriction Enzyme(s) EcoRI BamHI HindIII EcoRI and BamHI EcoRI and HindIII BamHI and HindIII 3 Practice ====•=•€ EX Fragment lengths (base pairs) 430 bp, 375 bp 470 bp, 335 bp Lab Report 6…
- ule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11AutoSave O Off # 2 Mol Bio Mutation QUESTIONS - Saved to this Pc - O Search A MST MCHUNU MT File Home Insert Design Layout References Mailings Review View Help Chemistry 合 Share P Comments (i) SIGN IN TO OFFICE It looks like your stored credentials are out of date. Please sign in as 20******@ke****** za so we can verify your subscription. Sign In Complete the following tasks. You are fresh recruits to a molecular biology laboratory, and your new boss has tasked you to study mutations in NRAS, a gene that she suspects is involved in cancer pathogenesis. Task A: Polymerase Chain Reaction Master Mix Your first task is to isolate and amplify the NRAS gene from CDNA extracted from different samples through PCR. You will need to run a total of 7 PCRS: 3 normal samples, 3 cancerous samples, and 1 negative control. To make things easier in the lab, when running multiple reactions, the components are prepared not individually, but as a master mix-all the components for multiple reactions are…abolism Lab - Compatibility Mode - Saved to this PC - Search References Mailings Review View Help Ericah Harpe 2 A A Aav Ap AaBbCcL AaBbCc] AABBCCI AaBbCcl AaBbCcD AABBC O Find , x A- I Av 。田、 e Replace A Select Emphasis 1 Heading 1 1 Normal Strong Subtitle Title Dictate Font Paragraph Styles Editing Voice A sample calculation based on a 154 lb male, age 20 would be: 154 lbs/2.2 = 70 kg 15.3 x 70 + 679 = 1750 kcal/day EXERCISE 1: Calculation of average BMR and Daily Caloric Needs: Calculate your estimated BMR using the above formula. It is best to recognize that this is a table based on statistical analysis and that each individual will have variations depending on their own body composition. If you have low thyroid hormone, your values would be less than these predicted values, for example. Muscle requires more energy than fat to sustain, therefore a person weighing 200 lbs who is lean and musculature will have a higher BMR than someone who weighs 200 lbs due to excess fat. Most…
- Draw the Haworth projection of B-L-altrose. You will find helpful information in the ALEKS Data resource. Explanation 2 Check # 3 Click and drag to start drawing a structure. $ 4 % 5 80 6 :: & 7 X S * 00 to v © 2023 McGraw Hill LLC. All Rights Reserved. Terr ( 9Copy and paste the link below and watch the video on Youtube https://www.youtube.com/watch?v=8RBs0Ghg_48 Answer the following Questions: 1. What are the chemicals and materials used in gel electrophoresis? 2. Draw a schematic diagram of a gel electrophoresis set-up 3. Describe the procedure in doing a gel electrophoresis experiment. Why is there a need for a leveling bubble/leveler? What is the use of the rubber dam? 4. What is the use of ethidium bromide and why must you wear gloves when you handle it? 5. What makes the DNA fragment move towards the positive plate? 6. What is the purpose of glycerol in the sample buffer? 7. What is the use of a DNA ladder? 8. What will happen when you increase the voltage of the set-up? 9. Can gel electrophoresis be used to separate amino acids? If so, how is it done?Drill 3 Peptide Structure and Sequencing [Compatibility Mode] - Word File Home Design Layout References Mailings Review View O Tell me what you want to do... Sign in 2 Share Insert X Cut P Find - Tahoma - 10.5 - A A Aa - AaBbCcl AaBbC AaBbCcI AaBbCc) AaBbCcD AaBbC AaBbCcI AaBbCcl 自Copy akc Replace Paste B I U - abE X, X A aby Emphasis Heading 1 I Normal Strong Subtitle Title I No Spac. Subtle Em.- A Select- Format Painter Clipboard Font Paragraph Styles Editing 1 4 • 5. L. 6 . . 7 : I· 8 . I. 9. 10 . I 11 . L. 12 13 . . 14 . I 15 AI 16 L A sample of a peptide of unknown sequence was treated with trypsin; another sample of the same peptide was treated with chymotrypsin. The sequences of the smaller peptides are the following, deduce the sequence of the original peptide. 2. Met-Val-Ser-Thr-Lys Val-Ile-Trp-Thr-Leu-Met-Ile Leu-Phe-Asn-Glu-Ser-Arg Trypsin treatment: Asn-Glu-Ser-Arg-Val-Ile-Trp Thr-Leu-Met-Ile Chymotrypsin treatment: Met-Val-Ser-Thr-Lys-Leu-Phe 21 Page 1 of 3 231 words…