Draw a generic dipeptide, and write out the mechanism describing its cleavage catalyzed by a serine protease. Upload your drawing below.
Q: 7. Draw a diagram of the heme complexes in deoxyhemoglobin and oxyhemoglobin (complete porphyrin…
A: A heme complex is a critical molecular structure found in various biological molecules, such as…
Q: A patient is suspected of having low stomach acid, a condition known as hypochloridia. To determine…
A: Acids and bases are two chemical substances that react with each other to form a salt and water.…
Q: What would spread (fragmented) bands in the electrophoresis gel tell you about the quality of your…
A: Gel electrophoresis is a technique used to separate DNA fragments according to their size. The DNA…
Q: Each of the reactions is catalyzed by an enzyme. For each reaction, classify the enzyme according to…
A: Most of the enzymes are divided into six major classes. They are1. Oxidoreductases2. Transferases3.…
Q: Explain why unfolding or aggregation may occur using changes in entropy and enthalpy of the protein…
A: Adding a small amount of salt into a protein solution can increase the solubility of the protein in…
Q: Estimate the apparent slope of the plot for myoglobin. myoglobin apparent slope = Estimate the…
A: The Hill plot is the graph we obtain by plotting at X-axis and at Y-axis. By looking at the value…
Q: The major difference between a protein molecule in its native state and in its denatured state lies…
A: The protein molecule is 150 residues long. So, there is 149 peptide bonds. It has been said that, in…
Q: Enzymes are important molecules in biochemistry that catalyze reactions. The energy diagram…
A: There are four types of biological macromolecule: proteins, nucleic acids, lipids and…
Q: The figure shown here is a Ramachandran plot. The plausible secondary structure that can be found in…
A: The Ramachandran plot is used to depict the statistical distribution of the combinations of the two…
Q: How many possible dipeptides can be formed from the amino acids aspartic acid, glutamine,…
A: Amino acids are biomolecules that have a hydrogen, a carboxyl group, an amino group and a chemically…
Q: Gamma turns are divided into two classes based on the phi and psi rotational bond angles of the…
A: An illustration of the permitted and forbidden areas of the phi and psi dihedral angles in the…
Q: 7. How many liters of a mouthwash can be prepared from 100 mL of cinnamon flavor if its…
A: To prepare a mouthwash with a concentration of 0.5% (v/v) cinnamon flavor, you need to calculate how…
Q: The amino acid shown below has an ionizable side chain with a pka of 4. When this amino acid is in a…
A: There are four types of biological macromolecules- proteins, nucleic acids, lipids and…
Q: 3. (a) In Bakers yeast there are two variants of cytochrome c, a heme containing protein of 108…
A: The ionizable groups in peptides/proteins (like cytochrome c) include the side chain groups (R…
Q: What is the hydrogen bonding pattern within an alpha helix? a. Lone pair on C=O of residue i to…
A: We have to determine the hydrogen bonding pattern within an alpha helix
Q: A researcher resolves a mixture of peptides using isoelectric focusing. Order the peptides based on…
A: The pH is a numerical measure of the acidity or alkalinity of a solution.The range of pH scale is 0…
Q: The active form of insulin contains No disulfide bonds Intra-chain disulfide bonds Inter-chain…
A: Insulin is a peptide hormone secreted by beta cells of pancreatic islets of Langerhans that…
Q: (a) Using the lecture entitled “On the Origin of life” by Jack Szostak. In one paragraph, summarize…
A: In his lecture titled "On the Origin of Life," Jack Szostak delves into the concept of an "RNA…
Q: A peptide has the sequence Gly-Ser-Lys-Ala-Gly-Gly-Arg-Ser-Arg. How many fragments would result from…
A: Trypsin is a serine protease. It cleaves peptides at the C-terminal side of Lysine (Lys) and…
Q: For this oligonucleotide, • Classify if RNA or DNA? Justify your choice. • Determine the sequence…
A: An oligonucleotide is a short sequence of nucleotides that is often made up of bases from DNA or…
Q: Classify the symmetrical arrangement of the subunits (e.g., C2 , C3 , D 2 , helical, icosahedral).…
A: Symmetry is a property of some biological molecules and structures that describes how they are…
Q: Draw the amino acids serine and threomine bonded together with a petide bond.
A: Amino acid
Q: In an ammonia molecule, one nitrogen atom (atomic number = 7; 1s² 2s²2p³) forms covalent bonds with…
A: Ammonia (NH3) is a colourless gas with a strong odour that is made up of one nitrogen atom coupled…
Q: Using a flowchart, illustrate and differentiate the flow of the electrons in the ETC when electrons…
A: NADH produced through glycolysis is present in the cytosol of the cell. The glycolytic pathway is…
Q: For each amino acid, show the structure, 1-letter abbreviation, 3-letter abbreviation, class…
A: Amino acids are the fundamental building blocks of life. They are the essential components of…
Q: A researcher has synthesized two peptides and needs to confirm whether the peptides were synthesized…
A: Tandem MS(also called MS/MS) and ElectroSpray Ionization-Time Of Flight Mass Spectroscopy…
Q: Draw a diagram of the tyrosine side chain. Show two ways in which the OH group of this side chain…
A: The molecular formula for the amino acid tyrosine is C9H11NO3. It features an extra hydroxyl group…
Q: 8. Draw a diagram to illustrate how hemoglobin is organized as a dimer of dimers (label the…
A: Hemoglobin is a protein found in red blood cells. In addition to carrying oxygen from the lungs to…
Q: Suppose the concentration of glucose inside a cell is 0.5 mM and the cell is suspended in a glucose…
A: Details
Q: Why does it make good metabolic sense for phosphoenolpyruvate carboxykinase, rather than pyruvate…
A: Gluconeogenesis is the metabolic pathway that produces glucose or glucose 6-phosphate from non…
Q: Consider an alpha-helix comprised of twelve amino acid residues. How many hydrogen bonds should be…
A: Proteins are linear polymers of amino acids which form the basic unit. Amino acids consist of a…
Q: These branching differences give the polysaccharides different properties. Use the above images to…
A: Polysaccharides are polymers made up of one or more types of monosaccharides. Polysaccharides made…
Q: Using the pka data for lysine, draw the molecular species present at each of the following pH values…
A: Lysine has 3 ionizable groups in it. They are;alpha- carboxyl groupalpha-amino groupside chain basic…
Q: Two possible point mutations are the substitution of lysine for leucine or the substitution of…
A: Amino acid mutations refer to changes in the DNA sequence that result in alterations to the sequence…
Q: Which statement about the glycoprotein shown below is true? OH CH₂OH OH HN HN-C O CH3 H₂ Protein CH…
A: Chemically, carbohydrates are polyhydroxy aldehydes or ketones. Monosaccharides are single unit…
Q: Draw a diagram of the hydrogen bonding interactions in: i) a two-stranded antiparallel beta sheet,…
A: Secondary structure of protein: Formed due to twisting of polypeptide chain.The folding is due to…
Q: Suppose a hypothetical "molecule X" binds to hemoglobin (at a different site than the O2 binding…
A: Hemoglobin is a globular protein, ie it is roughly spherical. It is a tetramer of two types of…
Q: Determine whether each of the amino acids is polar, nonpolar, positively charged, or negatively…
A: Amino acids are fundamental building blocks of life. They form the basic units that make up…
Q: Which foods are better at slowing down the rate of alochol absorption into the bloodstream?.
A: When alcohol is ingested, it is not digested and metabolised by our body. Instead, it enters the…
Q: beach in California and caught cute little crab and wanted to take it home. Knowing that it wouldn't…
A: Strength of a solution = mass of solute in grams / volume of solute in litresHere the solute is…
Q: Classify each of the following fatty acids as saturated, monounsaturated, or polyunsaturated.…
A: • Saturated fatty acids: saturated fatty acids are fatty acids that contain only single covalent…
Q: 1.DNA helicase 2.SSBP 3.DNA ligase 4.Primase 5.DNA Polymerase III A. Synthesizes RNA primer B.…
A: Deoxyribonucleic Acid (DNA), is a complex organic molecule is the hereditary material that carries…
Q: calculate the pI for tripeptide R-H-D
A: The pH of a solution at which a protein's net charge equals zero is called the isoelectric point…
Q: The shape for curve of oxygen binding to Myoglobin is curve of oxygen binding to Hemoglobin is Flat,…
A: Because of their distinct structure, myoglobin and hemoglobin have slightly different…
Q: Which of the above curves corresponds to myoglobin in a solution containing physiological…
A: The given curve is an oxygen dissociation curve. The curve depicts the relationship between the…
Q: Draw the Ala-Ser-Leu-Asp polypeptide (perspective formula) showing the fully extended backbone…
A: Proteins are folded peptides. Peptides are polymers made up of amino acid residues linked via a…
Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…
A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…
Q: Glucose-6- phosphatase catalyzes the following reaction: glucose – 6-phosphate + H2O = glucose +…
A: There are four types of biological macromolecules: proteins, nucleic acids, carbohydrates and…
Q: The pH is O High; Low Low; High in the lungs and in the muscles. O High in the lungs but there is no…
A: A substance's pH indicates how acidic or alkaline it is. "H" stands for hydrogen, and the pH scale…
Q: Calculate either [H3O+] or [OH-] for each of the solutions at 25 °C. Solution A: [OH¯] = 1.43 × 10¯7…
A: To calculate [H3O+] and [OH-] for each of the solutions, we can use the equation for the ion product…
Please don't provide handwrittensolution .....
Step by step
Solved in 3 steps with 1 images
- Indicate whether each of the following events occurs when tryptophan is high or when tryptophan is low by placing a check in each of the appropriate blanks. Share your reasoning. Event Tryptophan high Tryptophan low Ribosome does not stall at Trp codons ____________ ____________ Region 2 of the leader pairs with region 3 ____________ ____________ Ribosome covers part of region 2 of leader ____________ ____________ Transcription is terminated before structural genes are transcribed ____________ ____________Describe the function of the Bicoid protein. Explain how its ability to exert its effects in a concentration-dependent manner is a critical feature of its function.GTTTTCACTGGCGAGCGTCATCTTCCTACT9. Generate a FULL protein sequence alignment for one of the identified putative protein products with at least one similar invertebrate protein (if there is none, use a vertebrate homolog).
- Complete the protein synthesis for the partial DNA sequence for a normal FGFR3 gene (TOP) and mutated FGFR3 gene (BOTTOM). Remember, when filling in mRNA, use capital letters only. When filling in amino acids, use three letters, with the first letter capitalized. If you do not use this format, your answer may be marked wrong. DNA CCG TTC GGG GAA ССС MRNA Amino Acid DNA CCG TTC GGG GAA TCC MRNA Amino AcidStarting with an AA, 2n = 14 genome of Triticum urartu (wild einkorn wheat) and a BB, 2n = 14 genome of Triticum speltoides (wild grass), show a pathway to obtain AABBDD, 2n = 42 Triticum spelta (spelt wheat) that is commonly used in cereals, pasta, and bread. Show your work for full creditBudding yeasts such as S. cerevisiae exhibit telomerase activity throughout their life cycles, whereas human somatic cells do not exhibit telomerase activity. Suggest why this is so.
- A portion of the sequence from the DNA coding strand of the chick ovalbumin gene is shown. Determine the partial amino acid sequence of the encoded protein. CTCAGAGTTCACCATGGGCTCCATCGGTGCAGCAAGCATGGAA-(1104 bp)-TTCTTTGGCAGATGTGTTTCCCCTTAAAAAGAA Enter the 3-letter abbreviation for each amino acid in sequence, separated with dashes, and no spaces (example: xxx-xxx-XXX-XXX...) The amino acid sequence is .1104bp..…........You would like to add a nuclear localization sequence (NLS) of Lys-Lys-Lys-Arg-Lys to a protein that is usually found in the cytoplasm of a yeast cell. To accomplish this, you introduce the nucleotide sequence encoding the NLS into the gene that encodes the cytoplasmic protein of interest. a. What is the size of the nucleotide insert that will encode the NLS? Briefly explain. 5' 3' b. Below is a diagram of the gene encoding the cytoplasmic protein of interest in the yeast genome. If your goal is to put the NLS at the carboxyl (C) terminus of the protein, at which location (A-E) should the NLS be inserted? Briefly explain. A TATAA ATATT promoter +1 B ATG TAC D TAA ATT stop codon E 3' 5'This shows where EcoR1 cuts, where HindIII cuts, and where BstEII cuts. Given that the entire chromosome is 48,502 base pairs (as it says), figure out the fragment sizes you will expect if you cut it with EcoR1, or with HindIII, or with BseEII. Draw a map like the example attached " Show the sizes of each piece. Color code it according to which enzyme cut it.
- What are histone deacetylase inhibitors (HDACi)? Give example(s)The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence:AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK(a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein.(b) What are the cleavage sites using chymotrypsin?For the following sequence, what is the Tm? 5'-AGCTACGATCAGGTCA-3'