You would like to identify the protein subunits in a macromolecular complex. What kinds of biochemical or biophysical methods will you use and why? Please name one or two.
Q: What is cryopreservation? How do we reduce the risk of cell damage from osmolytic pressure in…
A: Cryopreservation is primarily used to preserve biological specimens. Individual cells and biological…
Q: please name and characterize the enzym class according to the given rraction C=O 0. CH ČH-OH C=O Ó.…
A: The given molecule is fructose-1,6-bisphosphate which is broken down to glyceraldehyde-3-phosphate…
Q: Answer the ff. questions: 1. What factors influence the metabolic rate of citrate in the…
A: The acetyl group of acetyl CoA is bonded to a four-carbon oxaloacetate molecules to generate a…
Q: Indicate at what step number in the glycolysis pathway the following event occur and why? a. First…
A: Isomerisation is defined as the reaction which alters a compound into its simple isomers which…
Q: Which of the following compounds is derived from arachidonic acid with the help of the enzyme…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: BACKGROUND A 2-year-old black girl is being seen by the hematologist after her pediatrician found…
A: Due to the lack of mitochondria, there is no TCA cycle occurring in the RBCs. So, RBCs obtain the…
Q: Given below is the DNA template. What are the gene products? 3’ TACCGGCCTATCTAGGGCCATGGCTTAATTCCC 5’…
A: DNA is the sequence of Nucleotides that are transcribed into mRNA during transcription. Once DNA is…
Q: 1. The following lipids are important structural components of the cell membrane of fish. Draw the…
A: The membrane phospholipids have a glycerol backbone.
Q: DATA TABLE Part I Specific Rotation of Sugars Angle blank (°): 71.8 Height (cm) Angle (*) Specific…
A: Every substance with the ability to rotate a plane polarized monochromatic light will have a…
Q: A student performed Benedict's reagent test on an monosaccharide. As she added Benedict's reagent to…
A: Benedict's reagent test is a test in which reducing monosaccharides sugars can be identified. Such…
Q: Which polymerase transcribes genes with internal control regions (ICR)? O RNA Pol I RNA Pol III RNA…
A: The eukaryotic cells have three distinct RNA polymerases that transcribe different sets of genes.
Q: Enzyme: Crystal Structure of Wild-Type Human Phosphoglucomutase-1 (PGM1) the description of the…
A: The enzyme PGM1 is very well known for its central role in specific human metabolism, where it…
Q: 1. Shown below is a metabolic pathway: Es E4 E F E1 E2 E3 A - B C- E6 Q R S E7 E8 Suppose we have…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Unsaturated fatty acids have ----. Question 16 options: multiple amide groups in their…
A: Fatty acids are the simplest form of lipids and serve as constituents in a large number of complex…
Q: A monosaccharide that consists of 5 carbon atoms, one of which is in a ketonegroup, is classified as…
A: Monosaccharides are simplest unit or basic unit of carbohydrate. general formula is CnH2nOn. it can…
Q: Why is it necessary to study the diffusion of molecules in biological systems? (а.) To understand…
A: Diffusion is the process of random motion of molecules in which there is a net flow of matter from a…
Q: te the structure for a generic triacylglyceride at pH 7.4.
A: ''Since you have asked multiple question , we will solve the first question for you . If you want…
Q: citric acid cycle
A: Citric acid cycle is one of the pathway of the carbohydrate metabolism which is also known as the…
Q: 4. Since pepsin is a gastric enzyme, does it have an acidic or alkaline optimum pH? What happens to…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: What term is typically used to describe gene systems that respond to the supply of a required…
A: These terms are generally used in operon models. An operon is a unit of bacterial gene expression…
Q: How do you calculate RNA concentration?
A: DNA and RNA are made up of long chains of nucleotides. Sugar molecule, ribose in RNA, and…
Q: Make an analysis of the electrophoresis data below. Comment on the purity, number of subunits, and…
A: Native gel electrophoresis is the process of separation without adding any denaturing agent like…
Q: The Lineweaver-Burke plots of a reaction without inhibitor and one with non-competitive inhibitor…
A: Enzymes are catalysts that enhance the rate of biochemical reactions.
Q: chemicals being applied for the leafy vegetables to produce seeds? If yes,
A: In today's world , almost all grown vegetables are being sprayed with pesticides, fungicides and…
Q: Human hemoglobin as a tetrameric protein of about 64.5KDa consists of 2 beta chains. Calculate the…
A: Hemoglobin : It is a iron containing metalloprotein found in red blood cells . Hemoglobin in the…
Q: Having peptides arranged in a beta sheet would be an example of a secondary structure A) True B)…
A: The Beta-pleated sheet is a sequence of anti-parallel chains of covalently-attached amino acids,…
Q: Starting with a 4-carbon growing fatty acid attached to the ketoacyl synthase (KSase) site, and a…
A: Fatty acid metabolism includes Fatty acid biosynthesis (an anabolic process) and β-…
Q: The structure below is a он NH но HO "он cerebroside monoglycosyl ceramide glycosphingolipid all are…
A: Lipids are a macro biomolecules made of fatty acid monomers, naturally occurring organic compounds…
Q: Differentiate the difference between saturated fat and unsaturated fat. Explain the chemical…
A: Fatty acids are important micromolecules which combine together to form lipids in plants, animals…
Q: Rifampicin attaches to the β subunit of bacterial RNA pol. Why is this used as an antibiotic to…
A: The main enzyme of bacterial RNA polymerase is made up of five subunits. The following are the…
Q: please name and characterize the enzym class according to the given rraction CH,O CH;O- ČH-OH C=O Ó.…
A: The given molecule in the question is fructose-1,6-bisphosphate (FBP). FBP is getting dissociated…
Q: During Anaphase chromosomes separate and move to ends of the cells. True False
A: During mitosis and meiosis , there are generally 4 phases:- Prophase Metaphase Anaphase…
Q: Consider the beta oxidation of stearic acid (C18:0): How many ATP are generated in complete…
A: Stearic acid has 18 C so 8 cycles are involved in its beta oxidation, One cycle yield 1 FADH2 and 1…
Q: hormone level in blood
A: ''Since you have asked multiple question , we will solve the first question for you. If you want any…
Q: Which of the following statements are correct? Explain your answers.A. An atomic nucleus contains…
A: Since the atom and nucleus were discovered. The bonding of a proton and a neutron, a proton and a…
Q: Loss of function mutation results in a _ allele.
A: Mutations are sudden changes in the gene sequence. When these changes causes loss of function of an…
Q: Some protein kinases are inactive unless they are phosphorylated on key serine or threonine…
A: The activity of many proteins are modulated by post-translational modification of the proteins.
Q: Lipids are soluble in --- and insoluble in ---, respectively. Question 3 options: organic…
A: Lipids contain many diverse groups of compounds that are mainly nonpolar in nature. Lipids are made…
Q: How many number of histone proteins present in a nucleosome? 4 6 9.
A: The nucleosome is the basic structural unit of DNA packaging in eukaryotes and represents a segment…
Q: Why is understanding reaction rates significant? Indicate at least 3 key importance of understanding…
A: Enzymes are biocatalyst that increases the speed of reaction by lowering the activation…
Q: Fluorescent proteins like the green fluorescent protein (GFP) found in jellyfish are a class of…
A: Proteins are composed of different types of amino acids (polar charged, polar uncharged, and…
Q: What is the name of proteins that relax supercoiled state of a DNA molecule are called? Polymerase…
A: During the process of transcription and DNA replication overwinding of the DNA duplex would lead to…
Q: Are proteins and enzyme the same in its structure and function. Why? Explain and provide an example…
A: Introduction: The human body contains a number of cells that perform various functions with the help…
Q: topic: gel electrophoresis What is the purpose of the running buffer?
A: The gel electrophoresis is a biochemical technique, which helps to separate the proteins and DNA,…
Q: Label the N-terminal and the C-terminal in the above peptide.
A: The amino acid residue on one end of a peptide molecule does have an amine group on the alpha…
Q: Enzymes occasionally display weak "side" activities. Draw the structure of the product (other than…
A: Pyruvate is formed in the last step of glycolysis with release of one ATP per molecule, catalyzed by…
Q: In the isolation of metabolites and tests for phytochemicals, why should people dry the leaves in…
A: Phytochemicals are compounds that are produced mostly by plants and have biological activity. Plants…
Q: Using punnet square, determine the chances of an autosomal recessive trait produced from the cross…
A: The Punnett square is used for the determination of genotype. Punnett square is a square diagram in…
Q: rue or false. The different subunits that a muscatinic acetylcholine receptor is made of determines…
A: An acetylcholine receptor which is also depicted as Achr is classified as an integral membrane…
Q: (Q39) A mutation in a certain protein results in the presence of a cysteine residue (rather than the…
A: A mutation is considered as a change in a DNA sequence. Mutations can easily result from specific…
Step by step
Solved in 2 steps
- 1) Explain chain-folded and spherulite structures. 2) A biomedical company is planning to design a robotic arm from polymeric biomaterials based on their stress-strain curves. You as a bioengineer/researcher in this company, are requested to choose the best material from different biomaterials (A, B, C, D, E, and F) based on their mechanical properties. Express your opinion shortly on the following questions? a) Difference between A and C? b) Difference between B and D? c) Difference between F and E? d) What would be your recommendation for the robotic arm? Why? Stress (MPa) 10.0 7.5 5.0 2.5 0.0 0 D Strain (%) 10 E F 15Discuss the process that helicases catalyze as well as some of the main components of their mechanics.Remember that DNA is a sequence of the letters A,C,T, and G. A binds with T and C binds with G. Solutions are specified by the DNA sequence, such as ACAC or TG, and by the concentration in units of micromolar (uM = 10-M) Consider mixing 30ml of 0.30µM ACAC with 45ml of 0.50pM TG. Predict what reactants and products should be present in the final solution and then check your answer in the virtual lab. (Please give your final answer in total nanomoles (10 moles) for each species in the solution)
- a Mixtureof the following amino acids is subjected to paper electrophoresis: Gly, Arg and Asp.Which of these amino acids will at (a) pH 2.0 and (b) pH 10 move to the Anode (+) and which will move to the cathode(-)? Motivate your answer.1. You need 0.5 liter of a 0.1 M buffer for a biochemical reaction that you plan to perform at pH 2.0. On the shelf in your laboratory you have available phosphoric acid, and the amino acids aspartate, glycine, glutamate, tyrosine, and histidine (all you have available are the fully deprotonated forms of the molecules); these are the only buffer materials you have available. (The pKa values for these compounds are given below.) For phosphoric acid, pKal1 = 2.12, pKa2 = 7.21, and pKa3 = 12.32 For aspartate, pKaCOOH = 1.88, pKaNH3+ = 9.60, pKa sidechain = 3.65 For glycine, pKaCOOH = 2.34, pKaNH3+ = 9.60 For glutamate, pKaCOOH = 2.19, pKaNH3+ = 9.67, pKa sidechain = 4.25 For histidine, pKɑCOOH = 1.82, pKɑNH3+ = 9.17, pKa sidechain = 6.00 For tyrosine, pKaCOOH = 2.20, pKaNH3+ = 9.11, pKa sidechain = 10.07 a. Of these possible buffers, which is likely to yield the greatest resistance to pH change from the starting pH of 2.0, assuming that you were going to run a biochemical reaction that…The vast majority of structures deposited in the Protein Databank (>95%) have been determined using NMR Hard keratins (such as in the skin) are less resistant to stretch because the larger number of disulfide bonds resist deformative forces. Structures produced by X-ray diffraction are as good as the solutions from which they are derived they are false and I know that but explain why they are false
- Two common methods of denaturing proteins in the lab are to increase the temperature and/or add chemical denaturants like the detergent SDS (shown below). Describe how each of these processes (heating and addition of SDS) disrupts the forces and interactions that stabilize the native state, leading to unfolding. The answer should include a discussion of the Gibbs free energy of folding, enthalpy, and entropy.What kind of techniques would be needed to take the structure properly taken into account in biochemical experiments?The concentration of protein in a solution can be determined via UV spectroscopy and colorimetry* techniques. Explain further on the statement, give examples of the techniques (please provide three examples for the colorimetry), general principles/mechanism, and general procedures of the techniques. You may use a Table to present the answer. If you need to choose a technique to measure your protein sample, what would be your choice? Justify your answer.
- What are the example of nanostructures? Give at least ten and define each Note: [Do not copy on Google!]How can you explain to a non-science person what is protein folding and how the concept is related to metabolic disorder. Explain in 2 paragraphs.The chain 3 subunit contains the amino acid sequence shown below. This sequence contains one alpha helix and the rest is random coil. Mark the region you believe will contain the alpha helix and explain your choice. In needed, feel free to use a helix wheel or other tools as part of your explanation. MNTFIIFIILIPIVGFALLAVNILLAVYKP D. Focus es) 9: J) ENG 83°F 6/19 DELL