Which amino acid sequence will form part of which protein structure, and why? Sequence 1: Ser-Phe-Gln-Val-Lys-Leu-His-Tyr-Asp-Val Sequence 2: Glu-Tyr-Leu-Asn-Phe-Ala-Gln-Val-Leu-Arg __Amphipathic beta strand __ Amphipathic alpha helix

Which amino acid sequence will form part of which protein structure, and why? Sequence 1: Ser-Phe-Gln-Val-Lys-Leu-His-Tyr-Asp-Val Sequence 2: Glu-Tyr-Leu-Asn-Phe-Ala-Gln-Val-Leu-Arg Amphipathic beta strand Amphipathic alpha helix

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Related questions

Q: The protein ribbon structure below, a single polypeptide, shows secondary structures in different…

A: Protein is a nitrogenous organic macromolecule that is essential to human health. It is responsible…

Q: Which amino acid residue's backbone forms a hydrogen bond with the backbone of the fifth (5th)…

A: Hello. Since your question has multiple parts, we will solve the first question for you. If you want…

Q: Which one of these characteristics is not true for the alpha helix? Proline is typically not found…

A: The alpha helix is a motif made up of amino acids arranged in a right-handed coil structure. It…

Q: How many alpha helices comprise this structure (2JHO-myoglobin)? Number the helices with helix 1 at…

A: The α-helix is a polypeptide backbone & a structural unit that can be distinguished to shifting…

Q: Two peptide segments are shown below. Predict which one would have the most negative AG when going…

A: Protein folding is a spontaneous reaction by which most of the proteins fold inside the cell without…

Q: Determining the amino acid sequence in a protein usually in- volves treating the protein with…

A: Treatment of a polypeptide with eleven amino acids with one reagent gives the following fragments :…

Q: Protein: Hemoglobin Circle and underline each codon, amino acid sequence, make a mutation of the 3rd…

A: Here the not cleared the mutation type, are point mutations, frame shift mutation, addition mutation…

Q: How many N-terminus are there in this cartoon?

A: *There are four types of protein structure are present. primary structure secondary structure…

Q: How to calculate the molecular weight of the given protein sequence;…

A: The given peptide is composed of glutamine, alanine, cysteine, glutamine, glutamine and isoleucine.…

Q: Protein folding

A: Proteins are composed of some 20 types of amino acid residues, and they would be more or less alike…

Q: V-B. Which of the following peptides would be more soluble at the indicated pH? 1. (Gly)20 or…

A: Proteins are macromolecules that are formed by the amino acids. Amino acids act as the subunits of…

Q: . Vwhat do you think holds together the various secondary structural elements in a Stickular…

A: These questions are about interactions in amino acids.

Q: The domain of a protien is approximately 350 residues in length. what is length (in A°) of this…

A: Proteins or peptides are the linear chains of amino acid sequences attached via peptide bonds. The…

Q: SYNZIPS are a-helices that can be used in synthetic biology to create coiled-coil interactions…

A: Secondary structure of protein describes the special arrangement of its main chain atoms, without…

Q: For each of the following sequences determine if they will most likely form an amphipathic α helix,…

A: Proteins are polymers of amino acids. The sequence of amino acids is governed by the sequences of…

Q: The amino acids leucine and threonine in general tolerate being in an alpha helix. However having…

A: α-Helix is formed by the hydrogen bonding between the backbone atoms of the polypeptide chain or…

Q: 46. The SH2 protein domain has 2 binding sites: one for ________ and one for _________. A.…

A: SH2 domains are protein modules which take part in the tyrosine kinase signaling pathways. These…

Q: Which peptide would absorb the most UV light at 280nm? (Can you show work because I mainly want to…

A: Aromatic amino acids are relatively non polar. All aromatic amino acids such as tyrosine,…

Q: Loop regions play important roles in the secondary structure of protein. Define loop region and…

A: Protein is a naturally occurring polymer that is made up of amino acids linked by peptide bonds.…

Q: Proteins constitute alpha-helices, beta-sheets, and loops. 1. Why more loops are better?

A: Introduction: . Proteins have primary, secondary, tertiary and quaternary structures each one has…

Q: At what level of protein structure (primary, secondary, tertiary, or quaternary) will protein…

A: Proteins are large-sized heteropolymeric macromolecules having two or more polypeptide chains. They…

Q: 4. Alpha helices, loops, and beta sheets are examples of protein secondary structure. Beta sheets…

A: Protein secondary structure is maintain by intrachain H-bond or interchain H-bond. In α-helix H-bond…

Q: Given the sequences below select all that may have trouble becoming alpha helices. (Select all that…

A: It is the amino acid sequence of a peptide chain that determine which secondary structure the…

Q: Functional conformation: Ultimately the functional conformation of a protein is determind by its…

A: The conformation of protein can be defined as an organization of the overall molecular shape in the…

Q: Which of the following sequences is most likely to form an unstructured loop in a protein structure?…

A: Proteins are polymers of amino acid sequences. Therefore they are known as polypeptides. There are…

Q: After treating one polypeptide with two different proteases (Trypsin and Chymotrypsin), shorter…

A: Introduction Peptides are short chains of amino acids with peptide bonds connecting them.…

Q: Protein structure.Circle one of the three amino acid sequences that is most likely to form a stable…

A: The common secondary structure of the protein are alpha-helix and beta-sheets. The alpha-helix are…

Q: Approximately how many domains are in an 82.5 kDa protein? O a. 2 Ob.3 OC 4 O d.1 QUESTION 5 How…

A: Domains are the regions of protein primary structure that vary in length from 50 aminoacids to 250…

Q: Among the secondary structures, which is most likely to form globular structures resulting from…

A: Explanation : In globular proteins, alpha helices and beta sheets are frequent secondary structural…

Q: Changing one amino acid within a protein sequence from a tryptophan to a stop codon would be best…

A: Mutation is the change in the nucleotide sequence of the DNA that causes a change in the mRNA.…

Q: Green Fluorescent Protein has regions that are very hydrophobic. What is the meaning of…

A: The cell membrane is a structure which protects the cell and acts as a barrier and transports the…

Q: o-H H. Hy-H H. From the N-terminus, this sequence is found on the 125th residue onwards. Based on…

A: Asked : If fragment is found in globular/fibrous protein

Q: Draw the structure of an α-helix (polypeptide backbone only, no side chains) as accurately as…

A: α-helix is the secondary structure of the proteins in which H-bonding play the predominant role.…

Q: Calculate the pI of both peptides. Which is more acidic and why?

A: Given sequence, PEPTIDE #1: Pro-Phe-Thr-Cys PEPTIDE #2: Gly-Tyr-Ser-Asp If the peptide does not have…

Q: Like a helices, B sheets often have one side facing the surface of the protein and one side facing…

A: Option D is the correct answer.

Q: secondary structure? O -KPGHP- O-KRKKK- -YFVWT- O-MRLEK-

A: Beta sheets are secondary structures of a protein that are formed due to interchain hydrogen bonding…

Q: The usual hydrophobic region of a membrane is around 30 Angstroms. Knowing this, about many amino…

A: The hydrophobic or water-hating part of a phospholipid containing long, nonpolar fatty acid tails.…

Q: Which of the following peptides is most likely to form an a-helix? ETAEKAFKQYANDN GLLKQSTQCLEVKT…

A: Most of the alpha-helix are transmembrane proteins

Q: Which of the following polypeptide chains is most likely to form an alpha-helix? GPSTRD EMA…

A: The amino acids make up the protein structure. The linear arrangement of amino acids with the help…

Q: Assume that the 3 polypeptide strands shown below form a parallel B-sheet. Select amino acids AA1,…

A: Beta sheet is one of type of secondary structure in which inter strand hydrogen bonds is formed…

Q: In SDS-PAGE. What chemical is used to ensure that all protein molecules are coated with a negative…

A: Ans SDS

Q: What would be shortest time a 250 amino acid protein would be able completely fold to the native…

A: Proteins are the building block of the body. They are macromolecules made up of amino acids as the…

Q: Like a helices, B sheets often have one side facing the surface of the protein and one side facing…

A: Alpha-helices and beta-sheets are examples of protein secondary structures. Secondary structure…

Q: Chaperonins provide an environment for unfolded proteins to fold away from other unfolded proteins.…

A: Chaperons are a group of proteins/biomolecules that play a major role in protein folding mechanism.…

Q: V-B. Which of the following peptides would be more soluble at the indicated pH? 1. (Gly)20 or…

A: There are two amino acids that are classified into 4 classes: 1. Nonpolar(aliphatic and aromatic) 2.…

Q: Suggest which part of this sequence belongs to the inner part of the protein and which to the outer…

A: Proteins are polypeptides formed of monomeric units-amino acids. There are 20 different amino acids…

Q: betaME on protein structure. The proteins don't contain any cysteine residues in its primary…

A: We are answering first question. For other question pls repost.

Q: Beta (B) sheets are a type of secondary structure in proteins. A segment of a single chain in an…

A: The beta-sheet is a type of secondary structure in which two strands are connected through backbone…

Q: Histones are a family of positively charged proteins binds tightly with negatively charged, DNA,…

A: Histones are a type of basic protein that binds to DNA in the nucleus and aids in the condensing of…

Q: 2. Of the two sequences, which is more likely to have helical structure. Explain. a)…

A: The amino acids are the protein structure alphabet; they can be arranged to create an almost…

Question

Which amino acid sequence will form part of which protein structure, and why?

Sequence 1: Ser-Phe-Gln-Val-Lys-Leu-His-Tyr-Asp-Val

Sequence 2: Glu-Tyr-Leu-Asn-Phe-Ala-Gln-Val-Leu-Arg

__Amphipathic beta strand

__ Amphipathic alpha helix

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step 3

VIEW

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

Which of the following polypeptides would be most likely to form an a helix? Explain your answer. Cys-Arg-Ala-Gly-Asn-Arg-Lys-Glu-Thr-Tyr-Ile-Val-LeuSer-Glu-Asp-Asn-Phe-Gly-Ala-Pro-Lys-Ser-Ile-Leu-TrpGln-Lys-Ala-Ser-Val-Glu-Met-Ala-Val-Arg-Asn-Ser-Gly β sheets are less likely to form than a helices during the earliest stages of protein folding. Explainwhy this is the case. (hint: think about the hydrogen bonding requirements)
Assume that the 3 polypeptide strands shown below form a parallel B-sheet. Select amino acids AA1, AA2, and AA3 so that the parallel B-sheet is amphipathic and remains stable. Glu-lle-Asn-AA1-Cys-Val Ser-AA2-GIn-Leu-Lys-Phe Lys-Met-Cys-Leu-AA3-Val O AA1 = Pro, AA2 = Leu, AA3 = lle O AA1 = Val, AA2 = Leu, AA3 = Asn O AA1 = Ala, AA2 = Gly, AA3 = Leu AA1 = Phe, AA2 = Arg, AA3 = Ala O O
A polypeptide is digested with trypsin, and the resulting segments are sequenced: Val-Gly Ala-Ala-Gly-Leu-Trp-Arg Arg-Asp-Pro-Gly-Lue-Met-Val-Leu-Tyr-Ala-Ala-Asp-Glu-Lys And the following fragments are produced by chymotrypsin fragmentation: Ala-Ala-Gly-Leu-Trp Arg-Arg-Asp-Pro-Gly-Leu- Met-Val-Leu-Tyr Ala-Ala-Asp-Glu-Lys-Val-Gly What is the sequence of the whole original polypeptide? (Recall that trypsin cleaves a polypeptide backbone at the C-terminal side of Arg or Lys residues, whereas chymotrypsin cleaves after aromatic amino acid residues).
A polypeptide is digested with trypsin, and the resulting segments are sequenced: Val-Gly Ala-Ala-Gly-Leu-Trp-Arg Arg-Asp-Pro-Gly-Lue-Met-Val-Leu-Tyr-Ala-Ala-Asp-Glu-Lys And the following fragments are produced by chymotrypsin fragmentation: Ala-Ala-Gly-Leu-Trp Arg-Arg-Asp-Pro-Gly-Leu- Met-Val-Leu-Tyr Ala-Ala-Asp-Glu-Lys-Val-Gly What is the sequence of the whole original polypeptide?
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Given the polypeptide chain below: Ala-Arg-Val-His-Asp-Gln 1. What is the N-terminus? 2.What is the C-terminus?
Glycosylation is a major type of protein post-translational modification. Identify the amino acid that is joined to each monosaccharide by a glycosidic bond. glycoprotein A glycoprotein B glycoprotein C HA HO Н CH₂OH HO OH Н H CH₂OH Н ОН HO HN-C-CH3 о c=0 NHI -NH-C - CH2C-H ОН Н нн ОН НН CH2OH Он OH HO Н NH 1 С=0 -CH2-C-н NH C=0 LO-CH2-C-H NH A В с
Changing one amino acid within a protein sequence from a tryptophan to a stop codon would be best classified as Amino acids groups Group Characteristics Names Ala, Val, Leu, Ile, Pro, Phe Trp, Met Ala: A Leu: L non-polar hydrophobic Arg: R Asn: N Lys: K Met: M Asp: D Cys: C Gly: G polar hydrophilic (non-charged) Gly , Ser, Thr, Cys, Tyr, Asn Gln Phe: F Pro: P Ser: S acidic negatively charged Asp, Glu Glu: E Gln: Q Thr: T His: H lle: I Trp: W Туr: Y Val: V basic positively charged Lys, Arg, His A) Conservative missense O B) Nonsense O C) Neutral O D) Non-conservative missense
Consider the following protein sequence as an α helix: Leu-Lys-Arg-Ile-Val-Asp-Ile-Leu-Ser-Arg-Leu-Phe-Lys-Val. how many turns does this helix make?
On average, how many phosphoanhydride bonds (P;-P; bonds) are directly hydrolyzed in thecourse of synthesizing a 200 amino acid protein? Assume that you begin with the mature mRNA,ribosomal subunits, tRNAs, free amino acids, and all necessary factors.
Treatment of a polypeptide by 2-mercaptoethanol yields two polypeptides that have the following amino acid sequences: Ala-Phe-Cys-Met-Tyr-Cys-Leu-Trp-Cys-Asn Val-Cys-Trp-Val-Ile-Phe-Gly-Cys-Lys Chymotrypsin-catalyzed hydrolysis of the intact polypeptide yields polypeptide fragments with the following amino acid compositions: (Ala, Phe) (Asn, Cys2, Met,Tyr) (Cys, Gly, Lys) (Cys2, Leu,Trp2,Val) (Ile, Phe,Val) Indicate the positions of the disulfide bonds in the original polypeptide. I don't understand how the order of amino acids in Step 2 was arranged. Please explain. Thank you.
Treatment of a polypeptide by 2-mercaptoethanol yields two polypeptides that have the following amino acid sequences: Ala-Phe-Cys-Met-Tyr-Cys-Leu-Trp-Cys-Asn Val-Cys-Trp-Val-Ile-Phe-Gly-Cys-Lys Chymotrypsin-catalyzed hydrolysis of the intact polypeptide yields polypeptide fragments with the following amino acid compositions: (Ala, Phe) (Asn, Cys2, Met,Tyr) (Cys, Gly, Lys) (Cys2, Leu,Trp2,Val) (Ile, Phe,Val) Indicate the positions of the disulfide bonds in the original polypeptide.