Using the skills you learnt in the DNA Analysis tutorial, correctly identify the gene and species of the following DNA sequence: TATGCCCTGGTTATCTTCGAGATGGTCCACCTGAAGGAGCTGGGGCTTTATAACCTCATG Gene: Insulin Receptor (INSR), Species: Mus Musculus Gene: Insulin Receptor (INS), Species: Homo Sapiens Gene: Epidermal Growth Factor Receptor (EGFR), Species: Homo Sapiens
Q: Criteria for Facilitated Diffusion Comparison Pinocytosis (Difference) (Similarity) (Choice)
A:
Q: Do algae reproduce sexually or asexually?
A: Algae are eukaryotic and photosynthetic organisms and range from unicellular forms like Chlorella to...
Q: Why do they look different? And why do they have different physical traits and phenotypes??
A: The DNA is the genetic material in living organisms that is made up of nucleotides. DNA is present i...
Q: Briefly describe how the use of different nitrogen isotopes allowed Meselson and Stahl to discern th...
A: The DNA replication is the process by which new DNA is produced from the old DNA. It follows the sem...
Q: Explain how domain shuffling could occur by recombination (crossing over) of different genes during ...
A: Domain shuffling is a process where gene segments coding functional domains are shuffled between dif...
Q: Do algae reproduce sexually or asexually?
A: Some algae reproduce by sexual reproduction, whereas others reproduce through asexual reproduction.
Q: Identify the sites of lagging strand synthesis. Select all that are true. B
A: DNA replication of the double-stranded DNA occurs simultaneously at both strands. The replication oc...
Q: Actin filaments have a defined polarity. What is filament polarity? How is it generated at the subun...
A: Introduction:- Actin filaments play a variety of roles in the cell. For one thing, they act as track...
Q: 33. Fundamental unit of heredity A. Loci B. Allele C. Chromosomes D. genetics
A: DNA or Deoxyribonucleic acid is the hereditary material in humans. RNA or ribonucleic acid. It helps...
Q: 13. Cervical spine 14. Lung radiographs 15. Diaphragm radiographs
A: Cervical spine : * patient position should be erect in AP view position and shoulders at equal dist...
Q: For the chromatogram below, what is the sequence of the template DNA from base 115 to 125? CTGTGTGAA...
A: According to the question, we have to answer the question that which is for the chromatograph below,...
Q: the probability of having an individual with at least a heterozygous gene pair of on its genotype f...
A: The cross between the two individuals can be represent as, Parents Genotype: Aabb × aabb Gametes...
Q: Are special chemicals administered to the plants to induce seed production? If yes, provide several ...
A: Seed It refers to an embryonic part that is covered by the protective outer covering called the seed...
Q: In pea plants, purple color is dominant to white. If a heterozygous purple is crossed with another h...
A: Introduction At a given gene locus, the presence of two distinct alleles. One normal allele and one ...
Q: A diploid organism has chromosomes. Use colours or symbols to show which chromosomes are which throu...
A: Meiosis is a process in which a single cell splits twofold to form four cells with half the number o...
Q: Which of the following is true about proteobacteria? Select all that apply. O they are gram negative...
A: Proteobacteria The proteobacteria are a major group(phylum) of bacteria. It includes a wide variety...
Q: Bacteria capable of growing on minimal media are considered which of the following? a. auxotrophs ...
A: culture media, also called growth media, are particular mixtures of nutrients and other materials th...
Q: Two chromosomes have the ff. order of genes: Normal A B centromere C D ...
A: a) Paracentric inversion: it's the type of inversion that doesn't involve the exchange of genes arou...
Q: Explain hospital and gas system (deep details)
A:
Q: How Plasmids are introduced into bacteria ?
A: Bacteria are the prokaryotes that have their DNA present in the cytoplasm.
Q: Question 1 From the list of strategies for dealing with harsh cold environments, choose those that a...
A: Ectotherms are cold-blooded animals whose body temperature fluctuates in response to their surroundi...
Q: What is the backbone of DNA ?
A: DNA stands for deoxyribonucleic acid, is the molecule that contains the genetic information of organ...
Q: IV. In 1-2 sentences, answer the following questions: 11. How does the law of segregation and indepe...
A: Genetics is the study of genes and how attributes are given starting with one age then onto the next...
Q: If a chimpanzee has a haploid (N) chromosome number of 24, how many chromosomes will be found in its...
A: A chimpanzee has 24 pairs of chromosomes in diploid condition. In haploid condition such as in ca...
Q: Imagine that ferredoxin is no longer able to participate in cyclic electron flow but is otherwise un...
A: Note: As per Bartleby Guidelines For Remaining Answers Please Repost The Question. Introduction: Pho...
Q: Question 4 Match each term with the appropriate description. Terms may not be matched at all or may ...
A: One of the main sugar found in our blood is glucose. Glycerol is the precursor of triglycerides prod...
Q: Evolution of ________ increased the energy availableto cells, making a larger genome and processes s...
A: Introduction Evolution is the process of a species' features changing over numerous generations thro...
Q: Solve for the genetic problems below. One point each for: a. genotype of the parents b. Punnett squa...
A: The alleles are the alternative forms of a gene that are located on the same locas of a homologous c...
Q: What can be the errors and limitations of Gel Electrophoresis practical? Explain in very much detail...
A: Errors and limitations of gel electrophoresis.
Q: II 4 III 3 Refer to the pedigree above. What is the genotype of person Il-1 if this pedigree for hem...
A: It is a sex-linked recessive trait.It is a disorder in which blood does not clot due to lack of clot...
Q: gy to explain vour am
A: In the case of the celery in salt water, water would leave the cells and the stalk will become wilte...
Q: Chronologically arrange the evolutionary events, with 1being the earliest and 6 the most recent.___ ...
A: Chronological event describe the timing of event as it occurred in the event of time period. Basical...
Q: List three ways in which mitosis differs from meiosis. Be specific MITOSIS MEIOSIS 1. 2. 3. 2. Wha...
A: Cell division The process by which cell proliferate and make new cells.
Q: you performed a sanger sequencing on a particular segment of DNA. Explain at the molecular level wha...
A: Effect on gel profile when we either forgot to add ddNTPs Or add more ddNTPs in test tubes during sa...
Q: The host cell in the endosymbiosis that produced the firstchloroplasts was a(n) ________.a. early eu...
A: Introduction Eukaryotes are organisms with a nucleus encased within a nuclear envelope in their cell...
Q: Given that out of the 64 codons of mRNA, 61 codify amino acids that form polypeptide chains, what ar...
A: As a result of the fact that there are 20 amino acids and 64 possible mRNA codons, some amino acids ...
Q: What causes the dark feet, ears, and nose of Himalayan rabbits? sex linkage and Barr bodies A gene i...
A: Introduction :- The Himalayan rabbit is a rare medium-sized rabbit that is sometimes confused with t...
Q: The human population was 6.0 billion in 1999 and has been growing ~ exponentially with an intrinsic ...
A: Introduction: A population is all the organisms of the same group or species, which live in a partic...
Q: . The human insulin gene is transcribed, translated and then placed in the bacterial cytoplasm.
A: Human insulin is the name which describes synthetic insulin which is laboratory grown to mimic the i...
Q: Ladder Pepsin Papain kDa 150 A B. 75 50 D, 25 12.5 | |
A:
Q: Why do you have to reduce the amount of light with the diaphragm in order to see bacteria in a hangi...
A: Microscope diaphragm Diaphragm or iris of microscope is found at the base of the microscope whose m...
Q: 11-15. In humans, widow's peak (H) is dominant over a continuous hairline (h), and short fingers (F)...
A: In this conditions, widow's peak (H) is dominant over a continuous hairline (h) , and short fingers ...
Q: Explain the several key properties of DNA vectors ?
A: Microbiology is the scientific study of single celled, multicellular, and acellular microorganisms. ...
Q: identify the hormone being described in each item, then encircle the letter of the correct answer. ...
A: Hormones are chemical substances produced by our body's endocrine system, which releases the hormone...
Q: Describe three (3) ways in which the primary transcript is modified as it is converted to mRNA.
A: When an RNA transcript is first made in a Eukaryotic cell , it is considered as pre - mRNA and it mu...
Q: The probability of having an individual recessive for all gene pairs from the cross Aabb x aaBb is O...
A: The detailed solution with Punnett square is discussed in the step 2
Q: In humans, the condition for normal blood clotting dominates the condition for nonclotting(hemophili...
A: Hemophilia is a X-linked recessive disorder that is responsible for defect in blood clotting. The he...
Q: Which of the following proteins are part of the first line of defense against microbial invasion? ...
A: The immune system in our body is responsible for providing protection against pathogenic microorgani...
Q: When a visual pigment absorbs photons of light, it changes its molecular shape and at the same time ...
A: Introduction: Rhodopsin is the pigment present in the retina of an eye.Iodopsin is the photosensitiv...
Q: What event/s during meiosis is simulated by the flipping of the coin? Explain these events briefly.
A: Meiosis is a sort of cell division that occurs in sexually reproducing creatures' germ cells and is ...
Using the skills you learnt in the DNA Analysis tutorial, correctly identify the gene and species of the following DNA sequence:
TATGCCCTGGTTATCTTCGAGATGGTCCACCTGAAGGAGCTGGGGCTTTATAACCTCATG
Gene: Insulin Receptor (INSR), Species: Mus Musculus
Gene: Insulin Receptor (INS), Species: Homo Sapiens
Gene: Epidermal Growth Factor Receptor (EGFR), Species: Homo Sapiens
Gene: Epidermal Growth Factor Receptor (EGFR), Species: Mus Musculus
Step by step
Solved in 2 steps with 1 images
- Design a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?* Google Translate x + re.com/courses/49703/quizzes/244266/take/questions/5315835 Understanding BAC-23 better might be the difference in curing cancer and saving millions of lives! You must sequence its genome and find the genetic code that makes the cancer curing protein. After running several tests, you have found the correct gene segment to be: GGG UCG ACA CUC UUU. Remember that bacteria are weird and their genes are made from a single strand with ribose sugar backbones! 1. Give the correct DNA template for this bacterial gene segment (GGG UCG ACA CUC UUU). ***Please use the following format or it will be marked incorrect*** Example: ABC DEF GHI JKL MNO, all caps, organized in threes with a space in between. Please make my life easier 2. Using the genetic code provided (GGG UCG ACA CUC UUU), translate this gene segment. ***Please use the following format or it will be marked incorrect*** Example: ABC DEF GHI JKL MNO, all caps, organized in threes with a space in between. Please make…Original DNA Sequence: TACAC CTTGG CGACGACT... MRNA Sequence: Amino Acid Sequence: Mutated DNA Sequence #5 TACACCTT G G GACGACT... (Highlight the change) What's the mRNA sequence? What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? 1. Which type of mutation is responsible for new variations of a trait? 2. Which type of mutation does not result in an abnormal amino acid sequence? 3. Which type of mutation stops the translation of an mRNA molecule? NO
- Ultraviolet light causes thymine dimers to form in DNA. Some individuals are genetically incapable of repairing these dimers at "normal" rates. Such individuals are likely to suffer from Oxeroderma pigmentosum phenylketonuria muscular dystrophy Severe Combined Immunodeficiency (SCID) pancreatic cancere.html?courseld=17594778&OpenVellum HMAC-977f3bf795c701a4bc0d750e73753852#10001 hesi book PubMed Google Scholar Citation Machine®:... S StuDocu - Free sum.... omework Activity: Figure 7.31 (1 of 2) Coccyx llium Pubis Sacrum Sacroiliac joint Hip bone (coxal bone) Pubic symphysis Ischium R 2019 Pearson Education in 5 Copyright © 2022 Pearson Education Inc. All rights reserved. | Terms of Use | Privacy Policy | Permissions | Contact Us | 6 & 7 P Pearson U 8 9 O ) 0 QL study room booking P PYou study the expression of the hexose kinase gene and capture the following electron micrograph of the gene being expressed. MRNA 20 ORI 40 60 3' ТТCGAGCTCTCСТCGTCGAGATACGCGAT SCGATGATATTAC: ТАСTGGTAATАTоGGGATGCACTAТС AAGCTCGAGAGCAGCAGCTCTATGCGCTACTATAATGACCANTATAÇCCCTACGTGATAG ΤΑTC 5' promoter RNA polymerase Practice Question 4 B) What is the sequence of the first 10 nucleotides of the transcript of this gene? 5' 3' ribosome
- Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton of a muscle fiber cell to the extracellular matrix. This connection strengthens and shapes the muscle fibers. Dystrophin is coded by the DMD gene. This is one of the longest human genes known, covering 2,300,000 base pairs (0.08% of the human genome) It is located in chromosome 21. The immature mRNA is 2,100,000 bases long and takes 16 hours to transcribe. It contains 79 exons. The mature mRNA measures 14,000 and codes for a protein with 3,685 amino acids. Abnormal expression of dystrophin leads to severe symptoms like muscle weakness and fatigability, a disease that is called muscular dystrophy. Most patients with muscular dystrophy become wheelchair dependent early in life. Cardiac muscle is also affected which results typically in premature death (~ second or third decade of life). Several mutations in this gene have led to the production of low levels of dystrophin or of a defective,…ASsume that a fish inherits a mutation in both the eye switch and the coding region of the Pitx1 gene. You isolate DNA from the jaw, pelvis, eye, and pituitary tissues. In which tissue(s) would you expect to see functional Pitx1 protein? Jaw Pelvis Actvator 1 Activator 2 Pary sch Jow swch Peve Phutory Jow Pevic swkh swich wkch Pitxt Pitx1 Eye 41 Pituitary Activulor 3 Adivutor 4 Phutary swich Pelvic Twach Jaw Putary Jaw Switch Pelvic wtch Satch sanch Pixt Pitt Figure 2 eye only jaw, pelvis, eye, and pituitary no tissues would have a functional protein jaw, pelvis, and pituitary only O O0 OABOUT Phenylketonuria Explain Potential technical issues and limitations of PCR technology are mentioned Correct information about tissue that can be used to test for a genetic disease and justification of tissue selection Detailed information about the position (exact base pair number) of the new mutation relative to the sequence of the PAH gene. Numbering is based on the start of transcription of the PAH gene. PLEASE ANSWER ALLLL PLEASEE
- Elaborate on the abbreviation RTP. What does it stand for? What is it usedfor?https://ny.pbslearningmedia.org/resource/biot09.sci.life.gen.epigenetics/epigenetics/ In what way do the brown and yellow mice shown in the video differ?Why is this so?Describe how HpaII and MspI can be used to determine if a given DNA sequence is methylated. Any limitations associated with these enzymes in Amyloid-β alters the DNA methylation status of cell-fate genes in an Alzheimer’s disease model paper. Taher, N., McKenzie, C., Garrett, R., Baker, M., Fox, N., & Isaacs, G. D. (2014). Amyloid-β alters the DNA methylation status of cell-fate genes in an Alzheimer’s disease model. Journal of Alzheimer’s Disease: JAD, 38(4), 831–844. https://doi.org/10.3233/JAD-131061