Manic-depressive illness Diabetes mellitus Sickle-cell anemia T-cell leukemia Liver-cell cancer B-cell leukemia Chromosome 11 The bands represent
Q: ould be a possible result if a essed in the cell?
A:
Q: Structures in the digestive tract that increase surface area for absorption are called: B alveoli…
A: Correct answer "Villi" is the finger like projection structure present in the digestive tract that…
Q: Which of the following does not occur during mitosis?
A: Mitosis (M-phase) can be defined as divisional phase of a cell cycle during which division of…
Q: What would happen to the observed and specific rotation values if you were to halve the path length…
A: Specific rotation is the degree rotation of a molecule which is observed when polarized light…
Q: Nick is a 34 year old male who is 72 " (6 ft) tall, weighs 228 pounds, and has a BMI of 31. Nick…
A: Introduction Obesity is a condition when there is an abnormal accumulation of body fat, which…
Q: What is the name of the structure that prevents back flow of food from the stomach to the esophagus?…
A: The digestive system is responsible for digestion, absorption and assimilation of nutrients.…
Q: Here is the sequence of an mRNA molecule: GUC/GGG/CUC/AGA/GAA What is the protein sequence that…
A: A codon is a group of three nucleotides that stands for a particular amino acid or signal to cease a…
Q: Discuss the genetic changes that influenza viruses undergo as they spread through the host species…
A: Influenza is an infection of the respiratory system, specifically the nose, throat, and lungs.…
Q: Glycogen synthesis and glycogen breakdown are catalyzed by separate enzymes. Contrast the reactions…
A: Glycogen is a carbohydrate, which is a polymer of glucose. Glycogen is also stored in human body as…
Q: Describe the structure of fungi.
A: Since fungi are heterotrophs, they are unable to manufacture their own food. As an alternative, they…
Q: The diagram shows a cell undergoing meiosis. Correctly label the diagram by dragging and dropping…
A: The process of meiosis occurs when sexually reproducing organisms divide their cells in a manner…
Q: A monocistronic mRNA is defined by… Group of answer choices The presence of a 5’ triphosphate The…
A: Genes are basically hereditary units which are involved in transmission of genetic information. This…
Q: (b) Label the following figure that shows the sequence of events by which cytotoxic T cells destroy…
A: Immunity is the body's ability to fight against foreign infection-causing particles. For this, the…
Q: Starting at the Superior and Inferior Vena Cava follow the arrows in the image above and list the…
A: The heart is the major pumping organ in circulatory system. It pumps the blood across body parts.
Q: When a(n) __________ moves along the sarcolemma, the membrane potential changes along the membrane…
A: The sarcolemma is the cell membrane of the muscle cells. When a muscle is stimulated by a neuron at…
Q: Looking at the composition of young children's gut microbiomes and how it changes under various…
A: Gut microbiome play a very important role in maintenance of a person's health. These microorganisms…
Q: How would an economist classify antibiotic use? Public health officials are concerned with the…
A: Antibiotics are the medicines which are used to prevent bacterial infections.When patients overuse…
Q: dehydrogenation
A:
Q: What system will reset the membrane potential after an action potential has moved along the…
A: voltage-gated Ca2+ channels will reset the membrane potential after an action potential has moved…
Q: 2. B cells proliferate and differentiate into plasma cells and memory cells in the secondary…
A: Introduction :- Differentiated B-lymphocyte white blood cells called plasma cells are able to…
Q: Which is the lightest: 5324 Cr+, 5224 Cr+, 5324 Cr2+, or 5224 Cr2+ ?
A:
Q: the
A:
Q: The outer most layer of bone is called: A) Periosteum B C Cortical bone Spongy bone Medullary cavity
A: Bone is a tissue that is made up of cells that produce an extracellular matrix that is mineralized…
Q: A cross between two parents that predicts the inheritance of two genes in the offspring is
A: Two study the inheritance of characters from parents to offspring, a genetic cross can be performed.…
Q: 6. Fill in the blanks and select the correct option [ A/B/C] in the paragraph below. Although both…
A: Cellular respiration: The process by which the cell utilizes the biochemical energy obtained from…
Q: When we take, say, 100 individuals of a species of beetle from the wild and place them in a new…
A: Option D is correct D - The population evolves to be tolerant of the lower temperature; it can do…
Q: Hello! Can you please help me with the following: a. Draw the basic batch growth curve and label…
A: Bacterial cells divide exponentially that is one cell divides into 2, 2 into 4, 4 into 8, 8 into 16,…
Q: (D) The addition of tryptophan to the growth medium of an E. coli trpR mutant lowers the expression…
A: Ans . D) Tryptophan (trp) operon is present in bacteria which is mainly responsible for producing…
Q: Actinomycin D inhibits DNA-dependent RNA synthesis. This antibiotic is added to a bacterial culture…
A: Antibiotics are isolated from microorganisms (bacteria). They use antibiotics to inhibits the growth…
Q: ted at the S phase of the cell cycl le to synthesise DNA. to divide even when they are tig unction…
A:
Q: Where does genetic foresight lead us?
A: introduction: Genetic Foresight offers a genetic test that sequences specific segments of patients'…
Q: What structure is responsible for getting minerals, molecules, and hormones from your various bodily…
A: Blood is responsible for the transport of different nutrients from one part of the body to another.…
Q: Explain and discuss how and why plants are cloned.
A: Plants that are grown by asexual process produce genetically same plants are known as their…
Q: Calculate how many triplet codons would be possible had evolution seized on six bases (three…
A: RNA is made up of four nucleotides: adenine, guanine, cytosine, and uracil. A triplet codon is an…
Q: State at least four functions of the kidneys other than forming urine.
A: The bean-shaped organ found in pairs in the body's abdominal cavity that functions in the urinary…
Q: State at least four functions of the kidneys other than forming urine.
A: The pair of bean-shaped organs located in the abdominal cavity that are responsible for production…
Q: interpret the given dot plot below from the protein sequences of M. leprae and M. ulcerans
A: Amino acids, the monomers of proteins, are involved in practically every biological activity, but…
Q: What are some selective advantages of being an efficiently bipedal hominin?
A: Evolution is a steady phenomenon which transform life from simple to more complex. Theories that…
Q: How reliable is PCR to detect microorganisms in water samples?
A: Polymerase chain reaction (PCR) is a technique discovered by Kary Mullis, which replicates DNA…
Q: Include a couple of paragraphs about Alkaline Phosphatase. Make sure you describe the following: a.…
A: A small pH range is required for the majority of enzymes to operate. When the pH is changed, the…
Q: (7) In a family-based alcohol use disorder genetic study, a total of 50 families, each with a pair…
A: We need to gauge hereditary inconsistancy because of heredity by utilizing the equation of…
Q: If the sequence of base pairs along a DNA molecule occurs strictly at random, what is the expected…
A: Introduction: The palindromic sequences that make up the restriction sites are where the restriction…
Q: Why are there so many mutations? What are the bacterial defense system differences from SARS-Cov 2…
A: Abrupt changes inside the DNA that may or may not change the amino acids sequence in a protein is…
Q: Which of the following reagents is NOT required for a PCR? a. DNA template b. DNA Polymerase…
A: PCR or polymerase chain reaction is a molecular biology tool that is used to amplify or to produce…
Q: the
A:
Q: ecological conditions
A: Evolution: It is defined as the process by which the species adapt over time in response to their…
Q: tropic
A:
Q: Formation of Acetyl-CoA-include NAD /NADH, pyruvate, coenzyme A, acetyl-CoA, and arbon dioxide…
A: Formation of acetyl coenzyme A is a second step in the aerobic oxidation. The first step being the…
Q: A bacterial promoter has the transcription start site at position: Group of answer choices -35 +20…
A: Ans : Transcription is the process in which the mRNA is made from DNA sequence with the help of the…
Q: If you were doing a cloning experiment where a plasmid was treated with PstI but the insert DNA did…
A: The cloning experiments need restrictions enzyme to cut the plasmid DNA at specific site. The…
![ch
*REQUIRED 1
12. The diagram below represent the banding pattern for human chromosome 11, with some
of the bands labeled.
Manic-depressive illness
Diabetes mellitus
Sickle-cell anemia
T-cell leukemia
Liver-cell cancer
B-cell leukemia
Ogenes
Chromosome 11
The bands represent
enzymes
proteins
carbohydrates
♥
d
6
0
CS](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2F3d2ac1b0-85e5-4533-922c-e1082f4827d5%2F5473eeae-f329-40ef-b59c-a66c58debb16%2Fyh9nv9a_processed.jpeg&w=3840&q=75)
![](/static/compass_v2/shared-icons/check-mark.png)
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
![Blurred answer](/static/compass_v2/solution-images/blurred-answer.jpg)
- . Mutations in an autosomal gene in humans cause aform of hemophilia called von Willebrand disease(vWD). This gene specifies a blood plasma proteincleverly called von Willebrand factor (vWF). vWFstabilizes factor VIII, a blood plasma protein specified by the wild-type hemophilia A gene. Factor VIIIis needed to form blood clots. Thus, factor VIII is rapidly destroyed in the absence of vWF.Which of the following might successfully be employed in the treatment of bleeding episodes in hemophiliac patients? Would the treatments workimmediately or only after some delay needed forprotein synthesis? Would the treatments have only ashort-term or a prolonged effect? Assume that allmutations are null (that is, the mutations result in thecomplete absence of the protein encoded by the gene)and that the plasma is cell-free.a. transfusion of plasma from normal blood into avWD patientb. transfusion of plasma from a vWD patient into adifferent vWD patientc. transfusion of plasma from a hemophilia A…Question:- 5. What happens when p53 senses that DNA damage is beyond repair? Why is thisadvantageous?G-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart ac
- Question: Hi, can someone help me with this question thanks in advance. Select one of the following genetic diseases that appear in the following list:galactosemiacystic fibrosisDown's Syndromefamilial hypercholesterolemiamuscle gystrophyHuntington's diseasesickle cell anemiahemophiliaTay-Sachs diseasedescribe a composition about how the selected condition is generated. Include details about the number of people who report the disease, symptoms, treatments, among other aspects that you consider important. thanks134 LABORATORY Size of the Cell U22T RAJUBAV RO OJA Shape of the Nucleus 916 91032 Degree of Chromatin Condensation Presence or Absence of Nucleoli Cytoplasmic Staining Blood Cells Presence of Cytoplasmic Granules Cytologic/Histologie 18: or cellule Bone Marrow Cells of the develo eveloping cells noil Identi 010III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…
- A small fraction—2 to 3%—of all cancers, acrossmany subtypes, displays a quite remarkable phenome-non: tens to hundreds of rearrangements that primarilyinvolve a single chromosome, or chromosomal region.The breakpoints can be tightly clustered, with several in afew kilobases; the junctions of the rearrangements ofteninvolve segments of DNA that were not originally closetogether on the chromosome. The copy number of varioussegments within the rearranged chromosome was foundto be either zero, indicating deletion, or one, indicatingretention.You can imagine two ways in which such multi-ple, localized rearrangements might happen: a progressiverearrangements model with ongoing inversions, deletions,and duplications involving a localized area, or a cata-strophic model in which the chromosome is shattered intofragments that are stitched back together in random orderby nonhomologous end joining (Figure Q20–2).A. Which of the two models in Figure Q20–2 accountsmore readily for the features of…134 LABORATORY MANUAL IN HUMAN HISTOLOGY ells U23T RAIUDBAL Size of the Cells Shape of the Nucleus Degree of Chromatin Condensation Presence or Absence of Nucleoli CE 1215) 1-XXI Blood Cells Cytoplasmic Staining Presence of Cytoplasmic Granules Bone Marrow Cell 29 3000 va 010 Na Y8 points total. Within the general field of biotechnology, DNA technology uses modern laboratory techniques for the studying and manipulation of genetic material. Explain how DNA might be sequenced, analyzed, and "cut and pasted" as DNA technology is employed. In addition, outline one way in which DNA technology could be employed to improve human lives. I 3
- Retinoblastoma: The Hits Just Keep Coming case study Part III – The Second Hit Questions A second hit might occur through epigenetic alterations. In the promoter of RB1, there is a CpG island. Knowing this, how might you predict that a cell could epigenetically inactivate RB1 transcription? A second hit might also occur through loss of heterozygosity (LOH). An example of how LOH may occur by reciprocal crossing over during mitosis is diagrammed in Figure 1 (next page). Discuss and interpret this model with your group. Write a brief explanation of (a) what LOH means and (b) how LOH by mitotic reciprocal crossing over can give rise to a cell lineage with functional loss of the wild-type copy of a tumor suppressor gene. . One of the ways that we know what the RB protein does in cells is that its inactivation is a common priority of tumor-initiating viruses. What advantage would a virus gain by inactivating RB function in its host cell? One example of a DNA virus (a virus that…Instructions -Answer thr Questions properly. MUTATION: Fill in the correct nucleotide base pairing and amino acid sequence of the mutated DNA "MUTATED DNA" (SEE IMAGE) a. What is the 3’-5’ DNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) b. What is the mRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) c. What is the tRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) d. What is the amino acid sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) e. What is the most convincing type of mutation had occurred? - Substitution - Missense (Frameshift resulting Missense; Frameshift resulting Nonsense; Substitution – Silent; Substitution – Missense; Substitution – Nonsense)Equalizing the Expression of X Chromosome Genes in Males and Females Individuals with an XXY genotype are sterile males. If one X is inactivated early in embryogenesis, the genotype of the individual effectively becomes XY. Why will this individual not develop as a normal male?
![Human Heredity: Principles and Issues (MindTap Co…](https://www.bartleby.com/isbn_cover_images/9781305251052/9781305251052_smallCoverImage.gif)
![Biology 2e](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
![Human Heredity: Principles and Issues (MindTap Co…](https://www.bartleby.com/isbn_cover_images/9781305251052/9781305251052_smallCoverImage.gif)
![Biology 2e](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)