Q: Which of the following statements is NOT TRUE about membrane transport? to facilitate movement of…
A: Cell membrane is made up of phospholipids and proteins and arranged in a fluid mosaic model. The…
Q: Which of the following statements is TRUE about phospholipids? The hydrophobic fatty acid tails on…
A: Phospholipids are amphiphilic molecules with hydrophobic fatty acid chains and hydrophilic moieties.
Q: Is there any form of matter or energy that could never be considered pollution? Briefly compare and…
A: Our modern lifestyle renders us more susceptible to many illnesses. With increased pollution and bad…
Q: If Chthamalus were the stronger competitor for space, what would happen to the range of Balanus in…
A: Introduction Ecological interaction is the relationship between two species, whether they are…
Q: Describe how coevolution, as with the hummingbird bill and hummingbird-pollinated flowers, is…
A: Coevolution is a multifaceted, intricate process. It can manifest in interactions among closely…
Q: why does DNA breathing occur?
A: Introduction: DNA serves as the template and substrate for many important biological processes,…
Q: Drawing of egg in distilled water drawing of egg in Normal Saline Solution drawing of egg in super…
A: These experiments are related to Osmosis. Osmosis is the process in which water move from higher…
Q: What does “prezygotic” mean?
A: The processes of reproductive isolation are a group of behavioural patterns, physiological…
Q: Many obese patients are part of a family in which all, or the majority, of it's members are obese.…
A: Genes are information/ trait encoding units present in the genome or DNA of organisms. These genes…
Q: 1. In a tabular form, summarize your observations of the responses of Paramecium to various stimuli…
A: Paramecium or Paramoecium is a genus of unicellular ciliated protozoa. They are characterized…
Q: Cell swelling will most directly affect which type of channel protein? Group of answer choices…
A: Cell swelling is an change that occurs in acute cell injury and It may be a simply disappear as the…
Q: What happens if plasma membrane fails to maintain optimal fluidity? • Describe structure/function of…
A: * plasma membrane is the envelope like structure that surrounds the cell and its organelles . *It is…
Q: Please answer fast What you chose to eat, when you chose to eat, and how much you chose to eat is a…
A: Eating is the process of breakdown and chewing of food. Eating is necessary for providing energy to…
Q: Which ( somatic or gametes) are made in the process of meiosis?
A: Cell cycle is a series of events that are responsible for producing daughter cells from parent cell.…
Q: The alternation of generations life cycle applies to gymosperms in that: A. the gametophyte stage…
A: Gymnosperms are vascular plants that produce seeds but not flowers.
Q: Define and give an example of coevolution.
A: Evolution is the process of change in heritable traits of biological organisms over successive…
Q: Glucose is taken up by red blood cells by binding to a specific pocket in a membrane protein which…
A: The study of chemical reactions that take place within and relate to live beings is known as…
Q: How is the booby’s ritual dance a prezygotic reproductive barrier?
A: Reproductive isolation is necessary for organisms to separate from their shared ancestors and propel…
Q: How would you design an experiment to determine whether two populations of snakes are distinct…
A: The most frequently recognised species idea is the biological one. Interbreeding is used to define…
Q: QUESTION 3 In Mendel's pea plants, round shape (R) is dominant to wrinkled shape (r), and yellow…
A: The inventor of modern genetics, an Austrian monk named Gregor Mendel, developed his rules of…
Q: Sickle cell anemia affects red blood cells by causing them to delivered efficiently to all parts of…
A: Red blood cells are present in the plasma of blood. The blood is a specialised connective tissue. It…
Q: Which species is the better interspecific competitor: Lemna polyrhiza O Lemna gibba O Lemna…
A: Introduction When individuals of different species fight for the same resources in an environment,…
Q: In a population of 50 hamsters, 60 of the alleles code for brown fur and 40 alleles code for black…
A: If the allele and genotype frequencies remain same generation after generation then we can say that…
Q: Is this DNA extraction procedure needed/necessary for COVID19 screening? If not, what is its…
A: Because of the rapid spread and rising number of cases of coronavirus disease 19 (COVID-19),…
Q: The following are the conditions that determines the direction of ions as it pass through the…
A:
Q: A DNA fragment was sequenced; however, the scatter-brained professor lost track of the direction of…
A: DNA stands for Deoxyribonucleic acid which is a long double helical tread-like structure. A single…
Q: What is the importance of the GUS gene? Why is using GUS with Arabidopsis thaliana important ?…
A: Explanation: Beta-glucuronidase is an enzyme that plays a role in the breakdown of plant cell…
Q: The difference in charge and chemical concentration across a membrane is known as
A: Gradient across membrane:- it represents the movement of molecules or ions across the membrane. It…
Q: Which statement among A - E is false? A. Microbes are ubiquitous → found everywhere B. Microbes…
A: Microbes are extremely minute living entities that are everywhere we look and are invisible to the…
Q: Which of the following occurs when red blood cells are transferred from an isotonic solution to a…
A: A solution is referred to as a Hypertonic solution when it has more solute concentration than water.…
Q: Explain the the following cell theory: - all living organism are composed of one or more cell -…
A: Cell Theory: According to the CELL THEORY, or cell theory, all creatures are made up of comparable…
Q: -Which drawing of the intertidal region correctly represents Chthamalus' fundamental niche with an…
A: Every species finds their own niche according to their feeding habits, living conditions, favourable…
Q: What is the function of gRNA in CRISPR-Cas technologies?It cuts DNA at a targeted sequence and…
A: Introduction There are two types of nucleic acids present in our cell, DNA and RNA. DNA acts as a…
Q: Batch fermentation under the conditions described in part b) is carried out in a 100-liter Remember…
A: Penicillins are prescribed to cure diseases such as sore throats, meningitis, syphilis, and others.…
Q: Pasteur used an S-necked flasks to disprove spontaneous generation. Explain the experiments that…
A: Spontaneous generation is a hypothesised theory that attempted to explain the origin of life…
Q: The difference in charge and chemical concentration across a membrane is known as Membrane gradient…
A: Electrochemical gradient is The gradient is made up of two components: an electrical gradient and a…
Q: Agarose gel electrophoresis can size fractionate DNA fragments. If a 1000 bp linear DNA fragment and…
A: When the agarose gel solidifies, a porous structure is created. A negative charge is applied to one…
Q: Which of these activities, that results in energy expenditure, makes up the greater portion of…
A: Introduction In the body, energy is used in a variety of ways. To carry out vital tasks such…
Q: What new connection/articulation is made by the tetrapod pelvic girdle, relative to fish? To which…
A: Introduction:- Fishes and tetrapods are categorised under the chordata because of the presence of…
Q: Select which statements are true 1. if oxygen concentration in the lumen of the colon increases,…
A: The correct option is 2 and 5
Q: xplain how the following affect membrane fluidity: – Level of phospholipid tail saturation – Level…
A: A plasma membrane is a selectively permeable membrane. It is made up of phospholipids, proteins and…
Q: Explain the three stages of cell signaling. a. receptor b. transduction c. response. Attach images
A: Introduction:- Cell signalling is a very important function of a cell because it allows a cell to…
Q: What is the purpose of checking the %GC in our NGS data? What is the ideal %GC value? Explain why…
A: Next Generation Sequencing is a DNA sequencing methodology by which the order of nucleotides in DNA…
Q: Why is it said that photosynthesis and cellular respiration are reverse chemical processes?
A: Photosynthesis :-it is the process of production of food (oxygen and glucose) in the plants by using…
Q: Describe the relevance of Bioinformatics in supporting the progress of Biotechnology.
A: Bioinformatics: Short for "biological Informatics", Bioinformatics is a new field of biotechnology…
Q: Question 15 Which of the following statements is TRUE of erythropoietin? O None of the above is true…
A: Erythropoietin is a hormone which stimulates the production and maintenance of red blood cells.
Q: Microorganism growth in complex natural environments such as soils and waters can be utilized to…
A: Introduction A subfield of biotechnology called "bioremediation" uses living things like bacteria…
Q: How to calculate actual size in μm
A: Three image-creation components must be considered to understand how microscopes work:…
Q: QUESTION 5 f a family with 15 members, 9 members had the A specific example of incomplete penetrance…
A: Given Out of 15 families only 9 have mutation And out of 9 families only 6 shows the disease.
Q: A. Drawing of Cell in Distilled Water Mount: (with Label) H₂₂0 H₂O H₂O H₂0 Drawing of Cell in Normal…
A: Figure A is of The cell is in isotonic solution. The flow of water is from both the side until…
Step by step
Solved in 3 steps with 1 images
- Each of the ff. involves a disorder in the function of an organelle or other cell structure. Identify the cell organelle or cell structure involved and indicate whether it is likely to be underactive or active. a) A baby is placed on a low phenylalanine diet as his newborn screening results revealed that he inherited phenylketonuria. b) A girl suddenly felt weak and manifested cyanide poisoning symptoms after ingesting undercooked cassava which contains cyanoglycosides. c) A man develops pleiomorphic liposarcoma (rare cancer). The cause of the problem is a hard mass of cells in his right inner thigh that rapidly increased in size in a matter of 2 months. d) A male chef learns that he is infertile because his sperm are non-motile. Helping tags: biology, cell biology, cell structure, cell organelleDrag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson archPredict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
- OalaMX Macron X E Macror x AlpQLScizmoeop5-4WA3yY20Vic8quirEip1r7NLKxf_bQYVnQYcjA/viewform?edit2-2 ABa proteins lipids nucleic acids carbohydrates The storage of glycogen in the muscles and liver in the body of a marathon runner is vital to providing the most preferred source of energy needed. Which the following meals would provide the best glycogen storage? * baked potato, bread, and pasta fruit salad and broccoli cheese soup fried chicken, cheese sticks, and gravy steak and eggs Glycogen is a polysaccharide of which type of macromolecule? allows FILL OUT A NEWA Classwork for BTMF_Itani_ Biolo x A S'ERRA STANLEY -protein-synth X O 8 period light reaction - Google S x google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit - protein-synthesis-worksheet_practice-converted O sert Format Tools Add-ons Help TUR Last edit was 10 minutes ago 0% Normal text Noto Sans BIUA 川。 三E▼=、三三 13 + 田回▼ 1 3 4. 5 8. DNA → TAC AGA CGG CAA CTC TGG GTG CTT TGT TCT CTT CTC AGT ATC mRNA → protein > Son out Co 4. 6. 8. 9.light reaction - Google: Jod. google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit NLEY-protein-synthesis-worksheet_practice-converted @ w Insert Format Tools Add-ons Help Last edit was 7 minutes ago 100% - Normal text Noto Sans . BIUA 12 川, 三三▼ 3 5 Y 6. 7 I 3. DNA → TAC CTT GGG GAA TAT ACA CGC TGG CTT CGA TGA ATC CGT ACG GTA CTC GCC ATC MRNA → protein → 4. DNA → TAA ACT CGG TAC CTA GCT TAG ATC TAA TTA CCC ATC mRNA → protein → 5. DNA - CTA TTA CGA TAC TAG AGC GAA TAG AAA CTT ATC ATC MRNA → protein → Sign out 围 Ce & 6. 8. 3. de 5
- er/classes/61227fd32e855b44e0a77ded/assignments/68b4e63d374f4e0394d0d06162fbaef2, Carbon Monosaccharide » Hydrogen • Oxygen CH OH 2. Use evidence from the diagrams of macromolecules and information provided earlier to revise your explanation about whether sugar molecules provide all the elements needed to make the four types of macromolecules. OH но OH H. OH Type your answer here. acerIdentify the level(s) of protein structure present in this molecule O Fearson Education, Inc. Select all that apply. A primary O secondary O tertiary 2 quaternary Submit Previous Answers Request AnswerS1.What functional group (pictured below) is used in the formation of ATP, the backbone of DNA, and the plasma membrane? R. - HO- asluolom OgH 910m ansa obyd to inuoms adisi69 101 P- Hnedenoi HO 9tom anisinos H 19w 1639 eniv blut viend ou nontel:oceansied bol-ngtsl s19 1591 a. Amino b. Carbonyl c. Ester d. Phosphate e. Alcohol Sabios onime Tertio of bensemoo Insietib ti aolem tsrll blas onims ns to neg at to quang ly snodibod for ogh quotg
- Aquaporins are proteins embedded in the plasmamembrane that allow water molecules to move betweenthe extracellular matrix and the intracellular space.Based on its function and location, describe the keyfeatures of the protein’s shape and the chemicalcharacteristics of its amino acids.Below is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP Which buffer(s) below would give this protein an overall positive charge? Select all that are correct Citric acid pH 3.25 Tris pH 8.5 Acetate pH 4.5 Phosphate pH 6.35 HEPES pH 7.5Explain shortly why ionizable characteristics of aminoacids are so important in protein structure and function.